Lineage for d1erra_ (1err A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6345Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
  4. 6346Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 6347Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (12 proteins)
  6. 6348Protein Estrogen receptor alpha [48519] (1 species)
  7. 6349Species Human (Homo sapiens) [TaxId:9606] [48520] (7 PDB entries)
  8. 6356Domain d1erra_: 1err A: [19298]

Details for d1erra_

PDB Entry: 1err (more details), 2.6 Å

PDB Description: human estrogen receptor ligand-binding domain in complex with raloxifene

SCOP Domain Sequences for d1erra_:

Sequence, based on SEQRES records: (download)

>d1erra_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens)}
alsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvpg
fvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifd
mllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtl
ihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllemlda
h

Sequence, based on observed residues (ATOM records): (download)

>d1erra_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens)}
alsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvpg
fvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifd
mllatssrfrmmnlqgeefvclksiillnsgvyeekdhihrvldkitdtlihlmakaglt
lqqqhqrlaqlllilshirhmsnkgmehlysmplydlllemldah

SCOP Domain Coordinates for d1erra_:

Click to download the PDB-style file with coordinates for d1erra_.
(The format of our PDB-style files is described here.)

Timeline for d1erra_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1errb_