Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (7 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (41 PDB entries) |
Domain d4jsug_: 4jsu G: [192971] Other proteins in same PDB: d4jsua_, d4jsue_, d4jsui_, d4jsuj_, d4jsuk_, d4jsul_, d4jsum_, d4jsun_, d4jsuo_, d4jsus_, d4jsuw_, d4jsux_, d4jsuy_, d4jsuz_ automated match to d1rypa_ complexed with mes |
PDB Entry: 4jsu (more details), 2.9 Å
SCOPe Domain Sequences for d4jsug_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jsug_ d.153.1.4 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia eqd
Timeline for d4jsug_: