Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (7 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (16 PDB entries) |
Domain d4jsqg_: 4jsq G: [192967] Other proteins in same PDB: d4jsqa_, d4jsqe_, d4jsqi_, d4jsqj_, d4jsqk_, d4jsql_, d4jsqm_, d4jsqn_, d4jsqo_, d4jsqs_, d4jsqw_, d4jsqx_, d4jsqy_, d4jsqz_ automated match to d1rypa_ complexed with mes |
PDB Entry: 4jsq (more details), 2.8 Å
SCOPe Domain Sequences for d4jsqg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jsqg_ d.153.1.4 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia eqd
Timeline for d4jsqg_: