Lineage for d1a52a_ (1a52 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2728396Protein Estrogen receptor alpha [48519] (1 species)
  7. 2728397Species Human (Homo sapiens) [TaxId:9606] [48520] (107 PDB entries)
    Uniprot P03372 307-551
  8. 2728560Domain d1a52a_: 1a52 A: [19296]
    complexed with au, est

Details for d1a52a_

PDB Entry: 1a52 (more details), 2.8 Å

PDB Description: estrogen receptor alpha ligand-binding domain complexed to estradiol
PDB Compounds: (A:) Estrogen receptor

SCOPe Domain Sequences for d1a52a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a52a_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
lalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvp
gfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveif
dmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdt
lihlmakagltlqqqherlaqlllilshirhmsnkgmehlysmkcknvvplydllleml

SCOPe Domain Coordinates for d1a52a_:

Click to download the PDB-style file with coordinates for d1a52a_.
(The format of our PDB-style files is described here.)

Timeline for d1a52a_: