SCOPe 2.05: Domain d4in6l_: 4in6 L:

Lineage for d4in6l_ (4in6 L:)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein L (light) subunit [81477] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81475] (61 PDB entries)
   Uniprot P02954

8. Domain d4in6l_: 4in6 L: [192954]
   Other proteins in same PDB: d4in6h1, d4in6h2, d4in6m_
   automated match to d1qovl_
   complexed with bcl, bph, cdl, fe, ggd, gol, hto, lda, pc1, po4, spo, u10; mutant

Details for d4in6l_

PDB Entry: 4in6, 2.7 Å

PDB Description: (m)l214a mutant of the rhodobacter sphaeroides reaction center

PDB Compounds: (L:) reaction center protein l chain

SCOPe Domain Sequences for d4in6l_:

Sequence; same for both SEQRES and ATOM records:

>d4in6l_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

Timeline for d4in6l_:

• d4in6l_ first appeared in SCOPe 2.02
  
• d4in6l_ appears in SCOPe 2.04
  
• d4in6l_ appears in SCOPe 2.06
  
• d4in6l_ appears in the current release, SCOPe 2.08