SCOPe 2.05: Domain d4ejkb_: 4ejk B:

Lineage for d4ejkb_ (4ejk B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (8 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (446 PDB entries)
   Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167

8. Domain d4ejkb_: 4ejk B: [192947]
   automated match to d3kfra_
   complexed with iop

Details for d4ejkb_

PDB Entry: 4ejk, 1.79 Å

PDB Description: hiv protease (pr) dimer in closed form with pepstatin in active site and fragment 1f1-n in the outside/top of flap

PDB Compounds: (B:) Protease

SCOPe Domain Sequences for d4ejkb_:

Sequence; same for both SEQRES and ATOM records:

>d4ejkb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwkrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigctlnf

Timeline for d4ejkb_:

• d4ejkb_ first appeared in SCOPe 2.02
  
• d4ejkb_ appears in SCOPe 2.04
  
• d4ejkb_ appears in SCOPe 2.06
  
• d4ejkb_ appears in the current release, SCOPe 2.08