SCOPe 2.06: Domain d4h84b1: 4h84 B:106-263

Lineage for d4h84b1 (4h84 B:106-263)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein automated matches [190182] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186920] (47 PDB entries)

8. Domain d4h84b1: 4h84 B:106-263 [192945]
   Other proteins in same PDB: d4h84a2, d4h84b2
   automated match to d1os9a_
   complexed with ca, gol, peg, pgo, pgr, y38, zn

Details for d4h84b1

PDB Entry: 4h84, 1.59 Å

PDB Description: crystal structure of the catalytic domain of human mmp12 in complex with a selective carboxylate based inhibitor.

PDB Compounds: (B:) Macrophage metalloelastase

SCOPe Domain Sequences for d4h84b1:

Sequence; same for both SEQRES and ATOM records:

>d4h84b1 d.92.1.11 (B:106-263) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslyg

Timeline for d4h84b1:

• d4h84b1 first appeared in SCOPe 2.02, called d4h84b_
  
• d4h84b1 was called d4h84b_ in SCOPe 2.05
  
• d4h84b1 appears in SCOPe 2.07
  
• d4h84b1 appears in the current release, SCOPe 2.08