Lineage for d4h84a1 (4h84 A:106-263)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964231Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2964641Protein automated matches [190182] (1 species)
    not a true protein
  7. 2964642Species Human (Homo sapiens) [TaxId:9606] [186920] (33 PDB entries)
  8. 2964663Domain d4h84a1: 4h84 A:106-263 [192944]
    Other proteins in same PDB: d4h84a2, d4h84b2
    automated match to d1os9a_
    complexed with ca, gol, peg, pgo, pgr, y38, zn

Details for d4h84a1

PDB Entry: 4h84 (more details), 1.59 Å

PDB Description: crystal structure of the catalytic domain of human mmp12 in complex with a selective carboxylate based inhibitor.
PDB Compounds: (A:) Macrophage metalloelastase

SCOPe Domain Sequences for d4h84a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h84a1 d.92.1.11 (A:106-263) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslyg

SCOPe Domain Coordinates for d4h84a1:

Click to download the PDB-style file with coordinates for d4h84a1.
(The format of our PDB-style files is described here.)

Timeline for d4h84a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4h84a2