Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein beta2-microglobulin [88600] (7 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88603] (222 PDB entries) Uniprot P01887 |
Domain d4huve_: 4huv E: [192939] Other proteins in same PDB: d4huva1, d4huva2, d4huvd1, d4huvd2 automated match to d1qo3b_ complexed with so4 |
PDB Entry: 4huv (more details), 2.5 Å
SCOPe Domain Sequences for d4huve_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4huve_ b.1.1.2 (E:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw sfyilahteftptetdtyacrvkhasmaepktvywdrdm
Timeline for d4huve_: