Lineage for d4h76a1 (4h76 A:106-263)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2570195Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2570196Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2570846Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2571256Protein automated matches [190182] (1 species)
    not a true protein
  7. 2571257Species Human (Homo sapiens) [TaxId:9606] [186920] (33 PDB entries)
  8. 2571277Domain d4h76a1: 4h76 A:106-263 [192936]
    Other proteins in same PDB: d4h76a2
    automated match to d1os9a_
    complexed with 10b, ca, gol, peg, pgo, zn

Details for d4h76a1

PDB Entry: 4h76 (more details), 1.5 Å

PDB Description: crystal structure of the catalytic domain of human mmp12 in complex with a broad spectrum hydroxamate inhibitor
PDB Compounds: (A:) Macrophage metalloelastase

SCOPe Domain Sequences for d4h76a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h76a1 d.92.1.11 (A:106-263) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslyg

SCOPe Domain Coordinates for d4h76a1:

Click to download the PDB-style file with coordinates for d4h76a1.
(The format of our PDB-style files is described here.)

Timeline for d4h76a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4h76a2