SCOPe 2.02: Domain d4h76a_: 4h76 A:

Lineage for d4h76a_ (4h76 A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein automated matches [190182] (2 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [192587] (12 PDB entries)

8. Domain d4h76a_: 4h76 A: [192936]
   automated match to d1os9a_
   complexed with 10b, ca, gol, peg, pgo, zn

Details for d4h76a_

PDB Entry: 4h76, 1.5 Å

PDB Description: crystal structure of the catalytic domain of human mmp12 in complex with a broad spectrum hydroxamate inhibitor

PDB Compounds: (A:) Macrophage metalloelastase

SCOPe Domain Sequences for d4h76a_:

Sequence; same for both SEQRES and ATOM records:

>d4h76a_ d.92.1.11 (A:) automated matches {Homo sapiens [TaxId: 9606]}
mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfa
rgahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighsl
glghssdpkavmfptykyvdintfrlsaddirgiqslyg

Timeline for d4h76a_:

• d4h76a_ is new in SCOPe 2.02-stable
  
• d4h76a_ appears in SCOPe 2.03
  
• d4h76a_ appears in the current release, SCOPe 2.08, called d4h76a1