Lineage for d4h49b1 (4h49 B:106-263)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964231Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2964641Protein automated matches [190182] (1 species)
    not a true protein
  7. 2964642Species Human (Homo sapiens) [TaxId:9606] [186920] (33 PDB entries)
  8. 2964680Domain d4h49b1: 4h49 B:106-263 [192930]
    Other proteins in same PDB: d4h49a2, d4h49b2, d4h49d2
    automated match to d1os9a_
    complexed with ca, dms, gol, l29, peg, pgo, zn

Details for d4h49b1

PDB Entry: 4h49 (more details), 2.16 Å

PDB Description: crystal structure of the catalytic domain of mmp-12 in complex with a twin inhibitor.
PDB Compounds: (B:) Macrophage metalloelastase

SCOPe Domain Sequences for d4h49b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h49b1 d.92.1.11 (B:106-263) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslyg

SCOPe Domain Coordinates for d4h49b1:

Click to download the PDB-style file with coordinates for d4h49b1.
(The format of our PDB-style files is described here.)

Timeline for d4h49b1: