Lineage for d3erda_ (3erd A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011944Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2011945Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2011946Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2012053Protein Estrogen receptor alpha [48519] (1 species)
  7. 2012054Species Human (Homo sapiens) [TaxId:9606] [48520] (64 PDB entries)
    Uniprot P03372 307-551
  8. 2012097Domain d3erda_: 3erd A: [19293]
    complex with diethylstilbestrol and a peptide
    complexed with acy, cl, des

Details for d3erda_

PDB Entry: 3erd (more details), 2.03 Å

PDB Description: human estrogen receptor alpha ligand-binding domain in complex with diethylstilbestrol and a glucocorticoid receptor interacting protein 1 nr box ii peptide
PDB Compounds: (A:) protein (estrogen receptor alpha)

SCOPe Domain Sequences for d3erda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3erda_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
slalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrv
pgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmvei
fdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitd
tlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydllleml
dahrlh

SCOPe Domain Coordinates for d3erda_:

Click to download the PDB-style file with coordinates for d3erda_.
(The format of our PDB-style files is described here.)

Timeline for d3erda_: