Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
Superfamily f.23.25: PetM subunit of the cytochrome b6f complex [103441] (1 family) |
Family f.23.25.1: PetM subunit of the cytochrome b6f complex [103442] (1 protein) |
Protein PetM subunit of the cytochrome b6f complex [103443] (2 species) |
Species Mastigocladus laminosus [TaxId:83541] [103444] (6 PDB entries) |
Domain d4i7zf_: 4i7z F: [192927] Other proteins in same PDB: d4i7za_, d4i7zb_, d4i7ze_, d4i7zg_, d4i7zh_ automated match to d1vf5s_ complexed with 1e2, 8k6, bcr, cd, cla, hem, mys, oct, oz2, umq |
PDB Entry: 4i7z (more details), 2.8 Å
SCOPe Domain Sequences for d4i7zf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i7zf_ f.23.25.1 (F:) PetM subunit of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]} teemlyaallsfglifvgwglgvlllkiqga
Timeline for d4i7zf_: