Lineage for d4fb1c_ (4fb1 C:)
- Root: SCOPe 2.07
Class g: Small proteins [56992] (98 folds) 
Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
disulfide-rich; nearly all-betaSuperfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) 
Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
automatically mapped to Pfam PF02975Protein Methylamine dehydrogenase [57563] (2 species) Species Paracoccus denitrificans [TaxId:266] [57564] (24 PDB entries) 
Domain d4fb1c_: 4fb1 C: [192925]
automated match to d2bbkl_
complexed with ca, hec, mes, na
Details for d4fb1c_
PDB Entry: 4fb1 (more details), 2.15 Å
PDB Description: Crystal Structure of WT MauG in Complex with Pre-Methylamine Dehydrogenase Aged 60 Days
PDB Compounds: (C:) Methylamine dehydrogenase light chainSCOPe Domain Sequences for d4fb1c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fb1c_ g.21.1.1 (C:) Methylamine dehydrogenase {Paracoccus denitrificans [TaxId: 266]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas
SCOPe Domain Coordinates for d4fb1c_:
Click to download the PDB-style file with coordinates for d4fb1c_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4fb1c_:
- d4fb1c_ first appeared in SCOPe 2.02
- d4fb1c_ appears in SCOPe 2.06
- d4fb1c_ appears in the current release, SCOPe 2.08
View in 3D
