Lineage for d4favc_ (4fav C:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1964111Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 1964112Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) (S)
  5. 1964113Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
    automatically mapped to Pfam PF02975
  6. 1964136Protein automated matches [190303] (3 species)
    not a true protein
  7. 1964137Species Paracoccus denitrificans [TaxId:266] [187112] (13 PDB entries)
  8. 1964152Domain d4favc_: 4fav C: [192924]
    automated match to d2bbkl_
    complexed with ca, edo, hec, mes, na, pge

Details for d4favc_

PDB Entry: 4fav (more details), 2.08 Å

PDB Description: Crystal Structure of WT MauG in Complex with Pre-Methylamine Dehydrogenase Aged 50 Days
PDB Compounds: (C:) Methylamine dehydrogenase light chain

SCOPe Domain Sequences for d4favc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4favc_ g.21.1.1 (C:) automated matches {Paracoccus denitrificans [TaxId: 266]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas

SCOPe Domain Coordinates for d4favc_:

Click to download the PDB-style file with coordinates for d4favc_.
(The format of our PDB-style files is described here.)

Timeline for d4favc_: