Lineage for d4favc_ (4fav C:)
- Root: SCOPe 2.08
Class g: Small proteins [56992] (100 folds) 
Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
disulfide-rich; nearly all-betaSuperfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) 
Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
automatically mapped to Pfam PF02975Protein Methylamine dehydrogenase [57563] (2 species) Species Paracoccus denitrificans [TaxId:266] [57564] (24 PDB entries) 
Domain d4favc_: 4fav C: [192924]
automated match to d2bbkl_
complexed with ca, edo, hec, mes, na, pge
Details for d4favc_
PDB Entry: 4fav (more details), 2.08 Å
PDB Description: Crystal Structure of WT MauG in Complex with Pre-Methylamine Dehydrogenase Aged 50 Days
PDB Compounds: (C:) Methylamine dehydrogenase light chainSCOPe Domain Sequences for d4favc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4favc_ g.21.1.1 (C:) Methylamine dehydrogenase {Paracoccus denitrificans [TaxId: 266]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas
SCOPe Domain Coordinates for d4favc_:
Click to download the PDB-style file with coordinates for d4favc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4favc_:
- d4favc_ first appeared in SCOPe 2.02
- d4favc_ appears in SCOPe 2.07
View in 3D
