Lineage for d4fa4c1 (4fa4 C:7-131)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2639172Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 2639173Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) (S)
  5. 2639174Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
    automatically mapped to Pfam PF02975
  6. 2639175Protein Methylamine dehydrogenase [57563] (2 species)
  7. 2639176Species Paracoccus denitrificans [TaxId:266] [57564] (24 PDB entries)
  8. 2639199Domain d4fa4c1: 4fa4 C:7-131 [192920]
    Other proteins in same PDB: d4fa4c2
    automated match to d2bbkl_
    complexed with act, ca, edo, hec, na, pge, po4

Details for d4fa4c1

PDB Entry: 4fa4 (more details), 2.14 Å

PDB Description: Crystal Structure of WT MauG in Complex with Pre-Methylamine Dehydrogenase Aged 10 Days
PDB Compounds: (C:) Methylamine dehydrogenase light chain

SCOPe Domain Sequences for d4fa4c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fa4c1 g.21.1.1 (C:7-131) Methylamine dehydrogenase {Paracoccus denitrificans [TaxId: 266]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas

SCOPe Domain Coordinates for d4fa4c1:

Click to download the PDB-style file with coordinates for d4fa4c1.
(The format of our PDB-style files is described here.)

Timeline for d4fa4c1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4fa4c2
View in 3D
Domains from other chains:
(mouse over for more information)
d4fa4e_