| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein Hemoglobin I [46464] (2 species) |
| Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (38 PDB entries) |
| Domain d4hrrg1: 4hrr G:4-149 [192919] Other proteins in same PDB: d4hrra2, d4hrrc2, d4hrre2, d4hrrg2 automated match to d1scta_ complexed with cmo, hem |
PDB Entry: 4hrr (more details), 1.25 Å
SCOPe Domain Sequences for d4hrrg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hrrg1 a.1.1.2 (G:4-149) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
avakvcgseaikanlrrswgvlsadieatglmlmsnlftlrpdtktyftrlgdvqkgkan
sklrghaitltyalnnfvdslddpsrlkcvvekfavnhinrkisgdafgaivepmketlk
armgnyysddvagawaalvgvvqaal
Timeline for d4hrrg1: