SCOPe 2.08: Domain d4hrtg1: 4hrt G:4-149

Lineage for d4hrtg1 (4hrt G:4-149)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin I [46464] (2 species)

7. Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [46465] (38 PDB entries)

8. Domain d4hrtg1: 4hrt G:4-149 [192916]
   Other proteins in same PDB: d4hrta2, d4hrtb1, d4hrtb2, d4hrtc2, d4hrtd1, d4hrtd2, d4hrte2, d4hrtf1, d4hrtf2, d4hrtg2, d4hrth1, d4hrth2
   automated match to d1scta_
   complexed with hem, po4

Details for d4hrtg1

PDB Entry: 4hrt, 1.46 Å

PDB Description: Scapharca tetrameric hemoglobin, unliganded

PDB Compounds: (G:) Globin-2 A chain

SCOPe Domain Sequences for d4hrtg1:

Sequence; same for both SEQRES and ATOM records:

>d4hrtg1 a.1.1.2 (G:4-149) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
avakvcgseaikanlrrswgvlsadieatglmlmsnlftlrpdtktyftrlgdvqkgkan
sklrghaitltyalnnfvdslddpsrlkcvvekfavnhinrkisgdafgaivepmketlk
armgnyysddvagawaalvgvvqaal

Timeline for d4hrtg1:

• d4hrtg1 first appeared in SCOPe 2.02, called d4hrtg_
  
• d4hrtg1 appears in SCOPe 2.07