![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
![]() | Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) ![]() |
![]() | Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins) |
![]() | Protein Progesterone receptor [48517] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48518] (10 PDB entries) Uniprot P06401 679-932 |
![]() | Domain d1a28b_: 1a28 B: [19291] complexed with str |
PDB Entry: 1a28 (more details), 1.8 Å
SCOPe Domain Sequences for d1a28b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a28b_ a.123.1.1 (B:) Progesterone receptor {Human (Homo sapiens) [TaxId: 9606]} lipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwskslpgfrnl hiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltmw qipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqkg vvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkila gmvkpllfh
Timeline for d1a28b_: