SCOPe 2.08: Domain d4it2a_: 4it2 A:

Lineage for d4it2a_ (4it2 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.278: Ligand-binding domain in the NO signalling and Golgi transport [111125] (1 superfamily)
   an N-terminal helical bundle and the C-terminal alpha-beta(2)-alpha-beta(2) subdomain enclose a ligand-binding cavity

4. Superfamily d.278.1: Ligand-binding domain in the NO signalling and Golgi transport [111126] (4 families)

5. Family d.278.1.1: H-NOX domain [111127] (2 proteins)
   binds heme between the N-terminal 4-helical bundle and the C-terminal alpha-beta(2)-alpha-beta(2) subdomains
   automatically mapped to Pfam PF07700

6. Protein Methyl-accepting chemotaxis protein [111128] (1 species)

7. Species Thermoanaerobacter tengcongensis [TaxId:119072] [111129] (18 PDB entries)
   Uniprot Q8RBX6 1-191

8. Domain d4it2a_: 4it2 A: [192901]
   automated match to d1u55a_
   complexed with mnh

Details for d4it2a_

PDB Entry: 4it2, 2.1 Å

PDB Description: mn(iii)-ppix bound tt h-nox

PDB Compounds: (A:) methyl-accepting chemotaxis protein

SCOPe Domain Sequences for d4it2a_:

Sequence; same for both SEQRES and ATOM records:

>d4it2a_ d.278.1.1 (A:) Methyl-accepting chemotaxis protein {Thermoanaerobacter tengcongensis [TaxId: 119072]}
mkgtivgtwiktlrdlygndvvdeslksvgwepdrvitpledidddevrrifakvsektg
knvneiwrevgrqniktfsewfpsyfagrrlvnflmmmdevhlqltkmikgatpprliak
pvakdaiemeyvskrkmydyflgliegsskffkeeisveevergekdgfsrlkvrikfkn
pvfe

Timeline for d4it2a_:

• d4it2a_ first appeared in SCOPe 2.02
  
• d4it2a_ appears in SCOPe 2.07