Lineage for d1a28a_ (1a28 A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 50844Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
  4. 50845Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 50846Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (14 proteins)
  6. 50903Protein Progesterone receptor [48517] (1 species)
  7. 50904Species Human (Homo sapiens) [TaxId:9606] [48518] (2 PDB entries)
  8. 50905Domain d1a28a_: 1a28 A: [19290]

Details for d1a28a_

PDB Entry: 1a28 (more details), 1.8 Å

PDB Description: hormone-bound human progesterone receptor ligand-binding domain

SCOP Domain Sequences for d1a28a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a28a_ a.123.1.1 (A:) Progesterone receptor {Human (Homo sapiens)}
qlipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwskslpgfrn
lhiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltm
wqipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqk
gvvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkil
agmvkpllfhk

SCOP Domain Coordinates for d1a28a_:

Click to download the PDB-style file with coordinates for d1a28a_.
(The format of our PDB-style files is described here.)

Timeline for d1a28a_: