Lineage for d1a28a_ (1a28 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2729393Protein Progesterone receptor [48517] (1 species)
  7. 2729394Species Human (Homo sapiens) [TaxId:9606] [48518] (10 PDB entries)
    Uniprot P06401 679-932
  8. 2729397Domain d1a28a_: 1a28 A: [19290]
    complexed with str

Details for d1a28a_

PDB Entry: 1a28 (more details), 1.8 Å

PDB Description: hormone-bound human progesterone receptor ligand-binding domain
PDB Compounds: (A:) progesterone receptor

SCOPe Domain Sequences for d1a28a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a28a_ a.123.1.1 (A:) Progesterone receptor {Human (Homo sapiens) [TaxId: 9606]}
qlipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwskslpgfrn
lhiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltm
wqipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqk
gvvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkil
agmvkpllfhk

SCOPe Domain Coordinates for d1a28a_:

Click to download the PDB-style file with coordinates for d1a28a_.
(The format of our PDB-style files is described here.)

Timeline for d1a28a_: