| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
| Family c.55.3.1: Ribonuclease H [53099] (5 proteins) |
| Protein BH0863-like Ribonuclease H [142490] (3 species) new class of RNase H |
| Species Bacillus halodurans [TaxId:86665] [142491] (21 PDB entries) Uniprot Q9KEI9 61-193! Uniprot Q9KEI9 62-193 BH0863 |
| Domain d4hueb_: 4hue B: [192899] automated match to d4htua_ protein/DNA complex; complexed with gol, mg |
PDB Entry: 4hue (more details), 1.56 Å
SCOPe Domain Sequences for d4hueb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hueb_ c.55.3.1 (B:) BH0863-like Ribonuclease H {Bacillus halodurans [TaxId: 86665]}
eeiiweslsvdvgsqgnpgiveykgvdtktgevlferepipigtnnmgeflaivhglryl
kernsrkpiysnsqtaikwvkdkkakstlvrneetaliwklvdeaeewlnthtyetpilk
wqtdkwgeikadyg
Timeline for d4hueb_: