Lineage for d4elgc_ (4elg C:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1180768Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 1180769Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 1181097Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 1181098Protein automated matches [190777] (8 species)
    not a true protein
  7. 1181099Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188674] (19 PDB entries)
  8. 1181114Domain d4elgc_: 4elg C: [192885]
    automated match to d3fl8a_
    complexed with 52i, 52j, ca, cl

Details for d4elgc_

PDB Entry: 4elg (more details), 2.1 Å

PDB Description: Structure-activity relationship guides enantiomeric preference among potent inhibitors of B. anthracis dihydrofolate reductase
PDB Compounds: (C:) dihydrofolate reductase

SCOPe Domain Sequences for d4elgc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4elgc_ c.71.1.0 (C:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mivsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpgrrn
iivtrnegyhvegcevahsveevfelckneeeififggaqiydlflpyvdklyitkihha
fegdtffpemdmtnwkevfvekgltdeknpytyyyhvyekqqlvpr

SCOPe Domain Coordinates for d4elgc_:

Click to download the PDB-style file with coordinates for d4elgc_.
(The format of our PDB-style files is described here.)

Timeline for d4elgc_: