SCOPe 2.06: Domain d4elbc1: 4elb C:1-162

Lineage for d4elbc1 (4elb C:1-162)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (21 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188674] (20 PDB entries)

8. Domain d4elbc1: 4elb C:1-162 [192880]
   Other proteins in same PDB: d4elba2, d4elbb2, d4elbc2, d4elbd2, d4elbe2, d4elbf2, d4elbg2, d4elbh2
   automated match to d3fl8a_
   complexed with 34r, 34s, ca, cl

Details for d4elbc1

PDB Entry: 4elb, 2.6 Å

PDB Description: Structure-activity relationship guides enantiomeric preference among potent inhibitors of B. anthracis dihydrofolate reductase

PDB Compounds: (C:) dihydrofolate reductase

SCOPe Domain Sequences for d4elbc1:

Sequence; same for both SEQRES and ATOM records:

>d4elbc1 c.71.1.0 (C:1-162) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mivsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpgrrn
iivtrnegyhvegcevahsveevfelckneeeififggaqiydlflpyvdklyitkihha
fegdtffpemdmtnwkevfvekgltdeknpytyyyhvyekqq

Timeline for d4elbc1:

• d4elbc1 first appeared in SCOPe 2.02, called d4elbc_
  
• d4elbc1 was called d4elbc_ in SCOPe 2.05
  
• d4elbc1 appears in SCOPe 2.07
  
• d4elbc1 appears in the current release, SCOPe 2.08