Lineage for d3lbda_ (3lbd A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2729427Protein Retinoic acid receptor gamma (RAR-gamma) [48515] (1 species)
  7. 2729428Species Human (Homo sapiens) [TaxId:9606] [48516] (9 PDB entries)
  8. 2729437Domain d3lbda_: 3lbd A: [19288]
    complexed with 9cr

Details for d3lbda_

PDB Entry: 3lbd (more details), 2.4 Å

PDB Description: ligand-binding domain of the human retinoic acid receptor gamma bound to 9-cis retinoic acid
PDB Compounds: (A:) retinoic acid receptor gamma

SCOPe Domain Sequences for d3lbda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lbda_ a.123.1.1 (A:) Retinoic acid receptor gamma (RAR-gamma) {Human (Homo sapiens) [TaxId: 9606]}
lspqleelitkvskahqetfpslcqlgkyttnssadhrvqldlglwdkfselatkciiki
vefakrlpgftglsiadqitllkaacldilmlrictrytpeqdtmtfsdgltlnrtqmhn
agfgpltdlvfafagqllplemddtetgllsaiclicgdrmdleepekvdklqeplleal
rlyarrrrpsqpymfprmlmkitdlrgistkgaeraitlkmeipgpmppliremlen

SCOPe Domain Coordinates for d3lbda_:

Click to download the PDB-style file with coordinates for d3lbda_.
(The format of our PDB-style files is described here.)

Timeline for d3lbda_: