SCOPe 2.08: Domain d4elgh1: 4elg H:1-162

Lineage for d4elgh1 (4elg H:1-162)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (28 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188674] (20 PDB entries)

8. Domain d4elgh1: 4elg H:1-162 [192877]
   Other proteins in same PDB: d4elga2, d4elgb2, d4elgc2, d4elgd2, d4elge2, d4elgf2, d4elgg2, d4elgh2
   automated match to d3fl8a_
   complexed with 52i, 52j, ca, cl

Details for d4elgh1

PDB Entry: 4elg, 2.1 Å

PDB Description: Structure-activity relationship guides enantiomeric preference among potent inhibitors of B. anthracis dihydrofolate reductase

PDB Compounds: (H:) dihydrofolate reductase

SCOPe Domain Sequences for d4elgh1:

Sequence; same for both SEQRES and ATOM records:

>d4elgh1 c.71.1.0 (H:1-162) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mivsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpgrrn
iivtrnegyhvegcevahsveevfelckneeeififggaqiydlflpyvdklyitkihha
fegdtffpemdmtnwkevfvekgltdeknpytyyyhvyekqq

Timeline for d4elgh1:

• d4elgh1 first appeared in SCOPe 2.02, called d4elgh_
  
• d4elgh1 appears in SCOPe 2.07