Lineage for d4elbe1 (4elb E:1-162)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2510888Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2510889Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2511486Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 2511487Protein automated matches [190777] (27 species)
    not a true protein
  7. 2511492Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188674] (20 PDB entries)
  8. 2511559Domain d4elbe1: 4elb E:1-162 [192876]
    Other proteins in same PDB: d4elba2, d4elbb2, d4elbc2, d4elbd2, d4elbe2, d4elbf2, d4elbg2, d4elbh2
    automated match to d3fl8a_
    complexed with 34r, 34s, ca, cl

Details for d4elbe1

PDB Entry: 4elb (more details), 2.6 Å

PDB Description: Structure-activity relationship guides enantiomeric preference among potent inhibitors of B. anthracis dihydrofolate reductase
PDB Compounds: (E:) dihydrofolate reductase

SCOPe Domain Sequences for d4elbe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4elbe1 c.71.1.0 (E:1-162) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mivsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpgrrn
iivtrnegyhvegcevahsveevfelckneeeififggaqiydlflpyvdklyitkihha
fegdtffpemdmtnwkevfvekgltdeknpytyyyhvyekqq

SCOPe Domain Coordinates for d4elbe1:

Click to download the PDB-style file with coordinates for d4elbe1.
(The format of our PDB-style files is described here.)

Timeline for d4elbe1: