Lineage for d4elhb1 (4elh B:1-162)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903429Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2903430Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2904032Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 2904033Protein automated matches [190777] (28 species)
    not a true protein
  7. 2904038Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188674] (20 PDB entries)
  8. 2904042Domain d4elhb1: 4elh B:1-162 [192874]
    Other proteins in same PDB: d4elha2, d4elhb2, d4elhc2, d4elhd2, d4elhe2, d4elhf2, d4elhg2, d4elhh2
    automated match to d3fl8a_
    complexed with 53i, 53j, ca, cl

Details for d4elhb1

PDB Entry: 4elh (more details), 2.1 Å

PDB Description: Structure-activity relationship guides enantiomeric preference among potent inhibitors of B. anthracis dihydrofolate reductase
PDB Compounds: (B:) dihydrofolate reductase

SCOPe Domain Sequences for d4elhb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4elhb1 c.71.1.0 (B:1-162) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mivsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpgrrn
iivtrnegyhvegcevahsveevfelckneeeififggaqiydlflpyvdklyitkihha
fegdtffpemdmtnwkevfvekgltdeknpytyyyhvyekqq

SCOPe Domain Coordinates for d4elhb1:

Click to download the PDB-style file with coordinates for d4elhb1.
(The format of our PDB-style files is described here.)

Timeline for d4elhb1: