| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) ![]() |
| Family c.71.1.0: automated matches [191485] (1 protein) not a true family |
| Protein automated matches [190777] (28 species) not a true protein |
| Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188674] (20 PDB entries) |
| Domain d4elee1: 4ele E:1-162 [192862] Other proteins in same PDB: d4elea2, d4eleb2, d4elec2, d4eled2, d4elee2, d4elef2, d4eleg2, d4eleh2 automated match to d3fl8a_ complexed with 31i, ca, cl |
PDB Entry: 4ele (more details), 2.35 Å
SCOPe Domain Sequences for d4elee1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4elee1 c.71.1.0 (E:1-162) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mivsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpgrrn
iivtrnegyhvegcevahsveevfelckneeeififggaqiydlflpyvdklyitkihha
fegdtffpemdmtnwkevfvekgltdeknpytyyyhvyekqq
Timeline for d4elee1: