![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
![]() | Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) ![]() |
![]() | Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins) |
![]() | Protein Retinoic acid receptor gamma (RAR-gamma) [48515] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [48516] (9 PDB entries) |
![]() | Domain d1exxa_: 1exx A: [19286] complexed with 961, lmu |
PDB Entry: 1exx (more details), 1.67 Å
SCOPe Domain Sequences for d1exxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1exxa_ a.123.1.1 (A:) Retinoic acid receptor gamma (RAR-gamma) {Human (Homo sapiens) [TaxId: 9606]} lspqleelitkvskahqetfpslcqlgkyttnssadhrvqldlglwdkfselatkciiki vefakrlpgftglsiadqitllkaacldilmlrictrytpeqdtmtfsdgltlnrtqmhn agfgpltdlvfafagqllplemddtetgllsaiclicgdrmdleepekvdklqeplleal rlyarrrrpsqpymfprmlmkitdlrgistkgaeraitlkmeipgpmppliremle
Timeline for d1exxa_: