Lineage for d1exaa_ (1exa A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6345Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
  4. 6346Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 6347Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (12 proteins)
  6. 6401Protein Retinoic acid receptor gamma (RAR-gamma) [48515] (1 species)
  7. 6402Species Human (Homo sapiens) [TaxId:9606] [48516] (8 PDB entries)
  8. 6406Domain d1exaa_: 1exa A: [19285]

Details for d1exaa_

PDB Entry: 1exa (more details), 1.59 Å

PDB Description: enantiomer discrimination illustrated by crystal structures of the human retinoic acid receptor hrargamma ligand binding domain: the complex with the active r-enantiomer bms270394.

SCOP Domain Sequences for d1exaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1exaa_ a.123.1.1 (A:) Retinoic acid receptor gamma (RAR-gamma) {Human (Homo sapiens)}
lspqleelitkvskahqetfpslcqlgkyttnssadhrvqldlglwdkfselatkciiki
vefakrlpgftglsiadqitllkaacldilmlrictrytpeqdtmtfsdgltlnrtqmhn
agfgpltdlvfafagqllplemddtetgllsaiclicgdrmdleepekvdklqeplleal
rlyarrrrpsqpymfprmlmkitdlrgistkgaeraitlkmeipgpmppliremle

SCOP Domain Coordinates for d1exaa_:

Click to download the PDB-style file with coordinates for d1exaa_.
(The format of our PDB-style files is described here.)

Timeline for d1exaa_: