Lineage for d1exaa_ (1exa A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2729427Protein Retinoic acid receptor gamma (RAR-gamma) [48515] (1 species)
  7. 2729428Species Human (Homo sapiens) [TaxId:9606] [48516] (9 PDB entries)
  8. 2729430Domain d1exaa_: 1exa A: [19285]
    complexed with 394, lmu

Details for d1exaa_

PDB Entry: 1exa (more details), 1.59 Å

PDB Description: enantiomer discrimination illustrated by crystal structures of the human retinoic acid receptor hrargamma ligand binding domain: the complex with the active r-enantiomer bms270394.
PDB Compounds: (A:) retinoic acid receptor gamma-2

SCOPe Domain Sequences for d1exaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1exaa_ a.123.1.1 (A:) Retinoic acid receptor gamma (RAR-gamma) {Human (Homo sapiens) [TaxId: 9606]}
lspqleelitkvskahqetfpslcqlgkyttnssadhrvqldlglwdkfselatkciiki
vefakrlpgftglsiadqitllkaacldilmlrictrytpeqdtmtfsdgltlnrtqmhn
agfgpltdlvfafagqllplemddtetgllsaiclicgdrmdleepekvdklqeplleal
rlyarrrrpsqpymfprmlmkitdlrgistkgaeraitlkmeipgpmppliremle

SCOPe Domain Coordinates for d1exaa_:

Click to download the PDB-style file with coordinates for d1exaa_.
(The format of our PDB-style files is described here.)

Timeline for d1exaa_: