SCOPe 2.07: Domain d1exaa_: 1exa A:

Lineage for d1exaa_ (1exa A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)

6. Protein Retinoic acid receptor gamma (RAR-gamma) [48515] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48516] (9 PDB entries)

8. Domain d1exaa_: 1exa A: [19285]
   complexed with 394, lmu

Details for d1exaa_

PDB Entry: 1exa, 1.59 Å

PDB Description: enantiomer discrimination illustrated by crystal structures of the human retinoic acid receptor hrargamma ligand binding domain: the complex with the active r-enantiomer bms270394.

PDB Compounds: (A:) retinoic acid receptor gamma-2

SCOPe Domain Sequences for d1exaa_:

Sequence; same for both SEQRES and ATOM records:

>d1exaa_ a.123.1.1 (A:) Retinoic acid receptor gamma (RAR-gamma) {Human (Homo sapiens) [TaxId: 9606]}
lspqleelitkvskahqetfpslcqlgkyttnssadhrvqldlglwdkfselatkciiki
vefakrlpgftglsiadqitllkaacldilmlrictrytpeqdtmtfsdgltlnrtqmhn
agfgpltdlvfafagqllplemddtetgllsaiclicgdrmdleepekvdklqeplleal
rlyarrrrpsqpymfprmlmkitdlrgistkgaeraitlkmeipgpmppliremle

Timeline for d1exaa_:

• d1exaa_ first appeared (with stable ids) in SCOP 1.55
  
• d1exaa_ appears in SCOPe 2.06