SCOPe 2.02: Domain d3zgfb_: 3zgf B:

Lineage for d3zgfb_ (3zgf B:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest

4. Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families)

5. Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (4 proteins)

6. Protein automated matches [190178] (3 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [192605] (8 PDB entries)

8. Domain d3zgfb_: 3zgf B: [192846]
   automated match to d3sxga_
   complexed with iug, mn, so4, udp; mutant

Details for d3zgfb_

PDB Entry: 3zgf, 1.7 Å

PDB Description: crystal structure of the fucosylgalactoside alpha n- acetylgalactosaminyltransferase (gta, cisab mutant l266g, g268a) in complex with in complex with npe caged udp-gal (p2(1)2(1)2(1) space group)

PDB Compounds: (B:) Histo-blood group ABO system transferase

SCOPe Domain Sequences for d3zgfb_:

Sequence; same for both SEQRES and ATOM records:

>d3zgfb_ c.68.1.9 (B:) automated matches {Homo sapiens [TaxId: 9606]}
slprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfaik
kyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevraykrwqdv
smrrmemisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpgfygssreaf
tyerrpqsqayipkdegdfyyggaffggsvqevqrltrachqammvdqangieavwhdes
hlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavp

Timeline for d3zgfb_:

• d3zgfb_ is new in SCOPe 2.02-stable
  
• d3zgfb_ appears in SCOPe 2.03
  
• d3zgfb_ appears in the current release, SCOPe 2.08