Lineage for d3zgfb_ (3zgf B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2898275Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2898276Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2898744Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (4 proteins)
    automatically mapped to Pfam PF03414
  6. 2898880Protein automated matches [190178] (2 species)
    not a true protein
  7. 2898887Species Human (Homo sapiens) [TaxId:9606] [186910] (75 PDB entries)
  8. 2898955Domain d3zgfb_: 3zgf B: [192846]
    automated match to d3sxga_
    complexed with iug, mn, so4, udp; mutant

Details for d3zgfb_

PDB Entry: 3zgf (more details), 1.7 Å

PDB Description: crystal structure of the fucosylgalactoside alpha n- acetylgalactosaminyltransferase (gta, cisab mutant l266g, g268a) in complex with in complex with npe caged udp-gal (p2(1)2(1)2(1) space group)
PDB Compounds: (B:) Histo-blood group ABO system transferase

SCOPe Domain Sequences for d3zgfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zgfb_ c.68.1.9 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfaik
kyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevraykrwqdv
smrrmemisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpgfygssreaf
tyerrpqsqayipkdegdfyyggaffggsvqevqrltrachqammvdqangieavwhdes
hlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavp

SCOPe Domain Coordinates for d3zgfb_:

Click to download the PDB-style file with coordinates for d3zgfb_.
(The format of our PDB-style files is described here.)

Timeline for d3zgfb_: