Lineage for d3v0qb_ (3v0q B:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1178199Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 1178200Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 1178492Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (4 proteins)
  6. 1178589Protein automated matches [190178] (3 species)
    not a true protein
  7. 1178596Species Homo sapiens [TaxId:9606] [192605] (8 PDB entries)
  8. 1178607Domain d3v0qb_: 3v0q B: [192845]
    automated match to d3sxga_
    complexed with bhe, gol, mn, so4, udp; mutant

Details for d3v0qb_

PDB Entry: 3v0q (more details), 1.8 Å

PDB Description: Crystal structure of the Fucosylgalactoside alpha N-acetylgalactosaminyltransferase (GTA, cisAB mutant L266G, G268A) in complex with UDP and H-antigen acceptor
PDB Compounds: (B:) Histo-blood group ABO system transferase

SCOPe Domain Sequences for d3v0qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v0qb_ c.68.1.9 (B:) automated matches {Homo sapiens [TaxId: 9606]}
aigefmvslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttig
ltvfaikkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevra
ykrwqdvsmrrmemisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpgfy
gssreaftyerrpqsqayipkdegdfyyggaffggsvqevqrltrachqammvdqangie
avwhdeshlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavpknhqavrnp

SCOPe Domain Coordinates for d3v0qb_:

Click to download the PDB-style file with coordinates for d3v0qb_.
(The format of our PDB-style files is described here.)

Timeline for d3v0qb_: