Lineage for d1fcxa_ (1fcx A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 923257Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 923258Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 923259Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 923838Protein Retinoic acid receptor gamma (RAR-gamma) [48515] (1 species)
  7. 923839Species Human (Homo sapiens) [TaxId:9606] [48516] (9 PDB entries)
  8. 923843Domain d1fcxa_: 1fcx A: [19284]
    complexed with 184, lmu

Details for d1fcxa_

PDB Entry: 1fcx (more details), 1.47 Å

PDB Description: isotype selectivity of the human retinoic acid nuclear receptor hrar: the complex with the rargamma-selective retinoid bms184394
PDB Compounds: (A:) retinoic acid receptor gamma-1

SCOPe Domain Sequences for d1fcxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fcxa_ a.123.1.1 (A:) Retinoic acid receptor gamma (RAR-gamma) {Human (Homo sapiens) [TaxId: 9606]}
spqleelitkvskahqetfpslcqlgkyttnssadhrvqldlglwdkfselatkciikiv
efakrlpgftglsiadqitllkaacldilmlrictrytpeqdtmtfsdgltlnrtqmhna
gfgpltdlvfafagqllplemddtetgllsaiclicgdrmdleepekvdklqepllealr
lyarrrrpsqpymfprmlmkitdlrgistkgaeraitlkmeipgpmppliremle

SCOPe Domain Coordinates for d1fcxa_:

Click to download the PDB-style file with coordinates for d1fcxa_.
(The format of our PDB-style files is described here.)

Timeline for d1fcxa_: