| Class a: All alpha proteins [46456] (179 folds) |
| Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) ![]() |
| Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (25 proteins) |
| Protein Retinoic acid receptor gamma (RAR-gamma) [48515] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [48516] (9 PDB entries) |
| Domain d1fcxa_: 1fcx A: [19284] complexed with 184, lmu |
PDB Entry: 1fcx (more details), 1.47 Å
SCOP Domain Sequences for d1fcxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fcxa_ a.123.1.1 (A:) Retinoic acid receptor gamma (RAR-gamma) {Human (Homo sapiens)}
spqleelitkvskahqetfpslcqlgkyttnssadhrvqldlglwdkfselatkciikiv
efakrlpgftglsiadqitllkaacldilmlrictrytpeqdtmtfsdgltlnrtqmhna
gfgpltdlvfafagqllplemddtetgllsaiclicgdrmdleepekvdklqepllealr
lyarrrrpsqpymfprmlmkitdlrgistkgaeraitlkmeipgpmppliremle
Timeline for d1fcxa_: