Lineage for d4eb9b_ (4eb9 B:)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1246163Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 1246164Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (1 family) (S)
  5. 1246165Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 1246166Protein 2MIHB/C-IAP-1 [57926] (1 species)
    baculoviral inhibitor of apoptosis
  7. 1246167Species Human (Homo sapiens) [TaxId:9606] [57927] (4 PDB entries)
  8. 1246172Domain d4eb9b_: 4eb9 B: [192837]
    automated match to d1qbha_
    complexed with 0o6, zn

Details for d4eb9b_

PDB Entry: 4eb9 (more details), 2.6 Å

PDB Description: cIAP1-BIR3 in complex with a divalent Smac mimetic
PDB Compounds: (B:) Baculoviral IAP repeat-containing protein 2

SCOPe Domain Sequences for d4eb9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eb9b_ g.52.1.1 (B:) 2MIHB/C-IAP-1 {Human (Homo sapiens) [TaxId: 9606]}
sisnlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwesg
ddpwvehakwfprceflirmkgqefvdeiqgryphlleqll

SCOPe Domain Coordinates for d4eb9b_:

Click to download the PDB-style file with coordinates for d4eb9b_.
(The format of our PDB-style files is described here.)

Timeline for d4eb9b_: