Lineage for d4eb9b_ (4eb9 B:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038051Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 3038052Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) (S)
  5. 3038053Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 3038054Protein 2MIHB/C-IAP-1 [57926] (1 species)
    baculoviral inhibitor of apoptosis
  7. 3038055Species Human (Homo sapiens) [TaxId:9606] [57927] (6 PDB entries)
  8. 3038061Domain d4eb9b_: 4eb9 B: [192837]
    Other proteins in same PDB: d4eb9c2, d4eb9d2
    automated match to d1qbha_
    complexed with 0o6, zn

Details for d4eb9b_

PDB Entry: 4eb9 (more details), 2.6 Å

PDB Description: cIAP1-BIR3 in complex with a divalent Smac mimetic
PDB Compounds: (B:) Baculoviral IAP repeat-containing protein 2

SCOPe Domain Sequences for d4eb9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eb9b_ g.52.1.1 (B:) 2MIHB/C-IAP-1 {Human (Homo sapiens) [TaxId: 9606]}
sisnlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwesg
ddpwvehakwfprceflirmkgqefvdeiqgryphlleqll

SCOPe Domain Coordinates for d4eb9b_:

Click to download the PDB-style file with coordinates for d4eb9b_.
(The format of our PDB-style files is described here.)

Timeline for d4eb9b_: