SCOPe 2.08: Domain d4eb9c1: 4eb9 C:255-355

Lineage for d4eb9c1 (4eb9 C:255-355)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
   metal(zinc)-bound alpha+beta fold

4. Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families)

5. Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)

6. Protein 2MIHB/C-IAP-1 [57926] (1 species)
   baculoviral inhibitor of apoptosis

7. Species Human (Homo sapiens) [TaxId:9606] [57927] (6 PDB entries)

8. Domain d4eb9c1: 4eb9 C:255-355 [192836]
   Other proteins in same PDB: d4eb9c2, d4eb9d2
   automated match to d1qbha_
   complexed with 0o6, zn

Details for d4eb9c1

PDB Entry: 4eb9, 2.6 Å

PDB Description: cIAP1-BIR3 in complex with a divalent Smac mimetic

PDB Compounds: (C:) Baculoviral IAP repeat-containing protein 2

SCOPe Domain Sequences for d4eb9c1:

Sequence; same for both SEQRES and ATOM records:

>d4eb9c1 g.52.1.1 (C:255-355) 2MIHB/C-IAP-1 {Human (Homo sapiens) [TaxId: 9606]}
isnlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwesgd
dpwvehakwfprceflirmkgqefvdeiqgryphlleqlls

Timeline for d4eb9c1:

• d4eb9c1 first appeared in SCOPe 2.02, called d4eb9c_
  
• d4eb9c1 appears in SCOPe 2.07