SCOPe 2.05: Domain d3vf7b_: 3vf7 B:

Lineage for d3vf7b_ (3vf7 B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (8 species)

7. Species Human immunodeficiency virus type 1 (bru isolate) [TaxId:11686] [194276] (20 PDB entries)

8. Domain d3vf7b_: 3vf7 B: [192833]
   automated match to d3pwma_
   complexed with 031, cl, gol, na; mutant

Details for d3vf7b_

PDB Entry: 3vf7, 1.3 Å

PDB Description: crystal structure of hiv-1 protease mutant l76v with novel p1'-ligands grl-02031

PDB Compounds: (B:) Protease

SCOPe Domain Sequences for d3vf7b_:

Sequence; same for both SEQRES and ATOM records:

>d3vf7b_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 (bru isolate) [TaxId: 11686]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvvvgptpvniigrnlltqigatlnf

Timeline for d3vf7b_:

• d3vf7b_ first appeared in SCOPe 2.02
  
• d3vf7b_ appears in SCOPe 2.04
  
• d3vf7b_ appears in SCOPe 2.06
  
• d3vf7b_ appears in the current release, SCOPe 2.08