SCOP 1.65: Domain d1fcza_: 1fcz A:

Lineage for d1fcza_ (1fcz A:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (25 proteins)

6. Protein Retinoic acid receptor gamma (RAR-gamma) [48515] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48516] (9 PDB entries)

8. Domain d1fcza_: 1fcz A: [19283]
   complexed with 156, lmu

Details for d1fcza_

PDB Entry: 1fcz, 1.38 Å

PDB Description: isotype selectivity of the human retinoic acid nuclear receptor hrar: the complex with the panagonist retinoid bms181156

SCOP Domain Sequences for d1fcza_:

Sequence; same for both SEQRES and ATOM records:

>d1fcza_ a.123.1.1 (A:) Retinoic acid receptor gamma (RAR-gamma) {Human (Homo sapiens)}
spqleelitkvskahqetfpslcqlgkyttnssadhrvqldlglwdkfselatkciikiv
efakrlpgftglsiadqitllkaacldilmlrictrytpeqdtmtfsdgltlnrtqmhna
gfgpltdlvfafagqllplemddtetgllsaiclicgdrmdleepekvdklqepllealr
lyarrrrpsqpymfprmlmkitdlrgistkgaeraitlkmeipgpmppliremle

Timeline for d1fcza_:

• d1fcza_ first appeared (with stable ids) in SCOP 1.55
  
• d1fcza_ appears in SCOP 1.63
  
• d1fcza_ appears in SCOP 1.67
  
• d1fcza_ appears in the current release, SCOPe 2.08