Lineage for d3u0yb_ (3u0y B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2898275Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2898276Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2898744Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (4 proteins)
    automatically mapped to Pfam PF03414
  6. 2898797Protein Glycosyltransferase A catalytic domain [75276] (1 species)
    involved in blood group antigen biosynthesis
  7. 2898798Species Human (Homo sapiens) [TaxId:9606] [75277] (59 PDB entries)
    Uniprot P16442 64-345
  8. 2898822Domain d3u0yb_: 3u0y B: [192827]
    Other proteins in same PDB: d3u0ya2
    automated match to d3sxga_
    complexed with gol, gti, mn, so4, udp; mutant

Details for d3u0yb_

PDB Entry: 3u0y (more details), 1.6 Å

PDB Description: Crystal structure of the Fucosylgalactoside alpha N-acetylgalactosaminyltransferase (GTA, cisAB mutant L266G, G268A) in complex with compound 382 and UDP
PDB Compounds: (B:) Histo-blood group ABO system transferase

SCOPe Domain Sequences for d3u0yb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u0yb_ c.68.1.9 (B:) Glycosyltransferase A catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
vslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfai
kkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevraykrwqd
vsmrrmemisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpgfygssrea
ftyerrpqsqayipkdegdfyyggaffggsvqevqrltrachqammvdqangieavwhde
shlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavp

SCOPe Domain Coordinates for d3u0yb_:

Click to download the PDB-style file with coordinates for d3u0yb_.
(The format of our PDB-style files is described here.)

Timeline for d3u0yb_: