SCOPe 2.08: Domain d1fcya_: 1fcy A:

Lineage for d1fcya_ (1fcy A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)

6. Protein Retinoic acid receptor gamma (RAR-gamma) [48515] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48516] (9 PDB entries)

8. Domain d1fcya_: 1fcy A: [19282]
   complexed with 564, lmu

Details for d1fcya_

PDB Entry: 1fcy, 1.3 Å

PDB Description: isotype selectivity of the human retinoic acid nuclear receptor hrar: the complex with the rarbeta/gamma-selective retinoid cd564

PDB Compounds: (A:) retinoic acid receptor gamma-1

SCOPe Domain Sequences for d1fcya_:

Sequence; same for both SEQRES and ATOM records:

>d1fcya_ a.123.1.1 (A:) Retinoic acid receptor gamma (RAR-gamma) {Human (Homo sapiens) [TaxId: 9606]}
aspqleelitkvskahqetfpslcqlgkyttnssadhrvqldlglwdkfselatkciiki
vefakrlpgftglsiadqitllkaacldilmlrictrytpeqdtmtfsdgltlnrtqmhn
agfgpltdlvfafagqllplemddtetgllsaiclicgdrmdleepekvdklqeplleal
rlyarrrrpsqpymfprmlmkitdlrgistkgaeraitlkmeipgpmppliremle

Timeline for d1fcya_:

• d1fcya_ first appeared (with stable ids) in SCOP 1.55
  
• d1fcya_ appears in SCOPe 2.07