Lineage for d3tayb1 (3tay B:64-224)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780402Family b.29.1.14: vp4 sialic acid binding domain [74907] (2 proteins)
    automatically mapped to Pfam PF00426
  6. 2780411Protein automated matches [190699] (4 species)
    not a true protein
  7. 2780415Species Porcine rotavirus [TaxId:31578] [189719] (3 PDB entries)
  8. 2780419Domain d3tayb1: 3tay B:64-224 [192819]
    Other proteins in same PDB: d3taya2, d3tayb2
    automated match to d2i2sa_
    complexed with ben, epe, mn0, mpd, na, so4

Details for d3tayb1

PDB Entry: 3tay (more details), 1.85 Å

PDB Description: crystal structure of porcine rotavirus crw-8 vp8* in complex with n- glycolylneuraminic acid
PDB Compounds: (B:) Outer capsid protein VP4

SCOPe Domain Sequences for d3tayb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tayb1 b.29.1.14 (B:64-224) automated matches {Porcine rotavirus [TaxId: 31578]}
lldgpyqpttfnpptsywillaptvegvviqgtnnidrwlatiliepnvqttnriynlfg
qqvtlsventsqtqwkfidvskttptgnytqhgslfstpklyavmkfsgriytyngttpn
attgyysttnydtvnmtsfcdfyiiprnqeekcteyinhgl

SCOPe Domain Coordinates for d3tayb1:

Click to download the PDB-style file with coordinates for d3tayb1.
(The format of our PDB-style files is described here.)

Timeline for d3tayb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3tayb2