SCOPe 2.05: Domain d4fl8a_: 4fl8 A:

Lineage for d4fl8a_ (4fl8 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (8 species)

7. Species Human immunodeficiency virus 1 [TaxId:11676] [224867] (48 PDB entries)

8. Domain d4fl8a_: 4fl8 A: [192818]
   automated match to d2aoda_
   complexed with cl, gol

Details for d4fl8a_

PDB Entry: 4fl8, 1.2 Å

PDB Description: HIV-1 protease complexed with gem-diol-amine tetrahedral intermediate

PDB Compounds: (A:) hiv-1 protease

SCOPe Domain Sequences for d4fl8a_:

Sequence; same for both SEQRES and ATOM records:

>d4fl8a_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf

Timeline for d4fl8a_:

• d4fl8a_ first appeared in SCOPe 2.02
  
• d4fl8a_ appears in SCOPe 2.04
  
• d4fl8a_ appears in SCOPe 2.06
  
• d4fl8a_ appears in the current release, SCOPe 2.08