Lineage for d4etwb_ (4etw B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706109Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 2706110Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins)
  6. 2706115Protein Acyl carrier protein [47338] (7 species)
  7. 2706168Species Shigella flexneri [TaxId:373384] [192502] (1 PDB entry)
  8. 2706169Domain d4etwb_: 4etw B: [192817]
    Other proteins in same PDB: d4etwa_, d4etwc_
    automated match to d1t8ka_
    complexed with zmk

Details for d4etwb_

PDB Entry: 4etw (more details), 2.05 Å

PDB Description: structure of the enzyme-acp substrate gatekeeper complex required for biotin synthesis
PDB Compounds: (B:) Acyl carrier protein

SCOPe Domain Sequences for d4etwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4etwb_ a.28.1.1 (B:) Acyl carrier protein {Shigella flexneri [TaxId: 373384]}
stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae
kittvqaaidyingh

SCOPe Domain Coordinates for d4etwb_:

Click to download the PDB-style file with coordinates for d4etwb_.
(The format of our PDB-style files is described here.)

Timeline for d4etwb_: